PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_11072.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 491aa    MW: 54077.6 Da    PI: 5.9607
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_11072.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.71.5e-15343381240
                      TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                              ++k+C+CkkskClk+YC+Cfaag +C e C+C++C+N+ 
  Rsa1.0_11072.1_g00002.1 343 SCKRCRCKKSKCLKLYCDCFAAGLYCVEPCSCQNCFNRP 381
                              589**********************************85 PP

2TCR482.4e-15429466239
                      TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                              +++gCnCkks ClkkYCeC+  g+ Cs +C+C +CkN 
  Rsa1.0_11072.1_g00002.1 429 HMRGCNCKKSGCLKKYCECYLMGVGCSASCRCIGCKNV 466
                              889**********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-16342383IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.751343468IPR005172CRC domain
PfamPF036385.2E-11345380IPR005172CRC domain
SMARTSM011142.1E-15428469IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-12431465IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MKADHVFHSL ALASPSSSLF SSPQIEESYR DSRFLIKRHH HSLDLSSPIA VLGETVKNTP  60
DILKRCQVKF AIELASSLRN GNDQMTTSSD EVVPMDDENE IAIRQSDGLC GQPNELDDSD  120
GVFRTEEMET ENGYGEQEIP NAKDPRINSF TSVPQQFSTN SRNVVQSRSV QVAGGAPDTT  180
LTSSSDVAAV GSTAKAEDKE ETGQQLSRKQ RSVRRRCLTF DAGGSYKRVP LRDSTNDLPL  240
DFTSIINEAS SPQKCVDSSK QETDEIVPIP RTIGLHLKAL VNPSASSNRN KSTSIDGCVL  300
SHAEEEFATP VSTINDLVSC DIQIMEEASE KSMEGEWVEE HGSCKRCRCK KSKCLKLYCD  360
CFAAGLYCVE PCSCQNCFNR PIHEDVVMKT RRNVEARNPL AFAPKVVLTS DSATYFGEES  420
NTTPASARHM RGCNCKKSGC LKKYCECYLM GVGCSASCRC IGCKNVICHT NEQFHFPCGL  480
EPDAVTNQRR I
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893291e-107AC189329.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB037C07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626556.10.0PREDICTED: protein tesmin/TSO1-like CXC 4
RefseqXP_013680988.10.0PREDICTED: protein tesmin/TSO1-like CXC 4
SwissprotQ84JZ80.0TCX4_ARATH; Protein tesmin/TSO1-like CXC 4
TrEMBLA0A0D3B9Q10.0A0A0D3B9Q1_BRAOL; Uncharacterized protein
STRINGBra001128.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148401620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04850.11e-160Tesmin/TSO1-like CXC domain-containing protein